| Sequence 1: | NP_649778.1 | Gene: | Nazo / 40976 | FlyBaseID: | FBgn0037562 | Length: | 140 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001078854.1 | Gene: | 1600014C10Rik / 72244 | MGIID: | 1919494 | Length: | 141 | Species: | Mus musculus |
| Alignment Length: | 134 | Identity: | 35/134 - (26%) |
|---|---|---|---|
| Similarity: | 76/134 - (56%) | Gaps: | 1/134 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MDSAISEIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGLTAYGL 65
Fly 66 TEGNFKSLSEVILNDLTESQRRELEQHVIRAISEVRNVRVRDVARLILNNRHVQEVALEAVKSYI 130
Fly 131 TDRM 134 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 106 | 1.000 | Domainoid score | I6589 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 106 | 1.000 | Inparanoid score | I4916 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG50112 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0003581 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR31493 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X2933 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 8.070 | |||||