| Sequence 1: | NP_649778.1 | Gene: | Nazo / 40976 | FlyBaseID: | FBgn0037562 | Length: | 140 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006228976.1 | Gene: | LOC690000 / 690000 | RGDID: | 1585208 | Length: | 145 | Species: | Rattus norvegicus |
| Alignment Length: | 137 | Identity: | 39/137 - (28%) |
|---|---|---|---|
| Similarity: | 80/137 - (58%) | Gaps: | 7/137 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MDSAISEIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGLTAYGL 65
Fly 66 TEGNFKSLSEVILNDLTESQRRELEQHVIRAISEVRNVRVRDVAR---LILNNRHVQEVALEAVK 127
Fly 128 SYITDRM 134 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 107 | 1.000 | Domainoid score | I6395 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 107 | 1.000 | Inparanoid score | I4829 |
| OMA | 1 | 1.010 | - | - | QHG50112 | |
| OrthoDB | 1 | 1.010 | - | - | D1474873at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003581 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR31493 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X2933 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 10.080 | |||||