DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nazo and zgc:101715

DIOPT Version :9

Sequence 1:NP_649778.1 Gene:Nazo / 40976 FlyBaseID:FBgn0037562 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001004633.1 Gene:zgc:101715 / 447894 ZFINID:ZDB-GENE-040912-59 Length:141 Species:Danio rerio


Alignment Length:128 Identity:44/128 - (34%)
Similarity:72/128 - (56%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGLTAYGLTEGNFK 71
            :||.....::.||.||...|.:.||||:..|.|.:|||:.||.|:|||.|:||.....:|.|.|:
Zfish     7 DIIKFCCEISADKKIQAAFKGSAKGAAVAGGGAFVGGLIGGPAGIALGAAVGGALGAWMTSGQFR 71

  Fly    72 SLSEVILNDLTESQRRELEQHVIRAISEVRNVRVRDVARLILNNRHVQEVALEAVKSYITDRM 134
            .|.|::: :||.||:.:|...|:..:..::...|..:...:..|..:||..|.|:.||..:::
Zfish    72 PLPEILM-ELTPSQQDKLYSDVMAIVGSLKWTDVPQLMAQVHGNSSLQEQVLGAILSYTKNQL 133



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6567
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4918
OMA 1 1.010 - - QHG50112
OrthoDB 1 1.010 - - D1474873at2759
OrthoFinder 1 1.000 - - FOG0003581
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31493
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.