Sequence 1: | NP_649778.1 | Gene: | Nazo / 40976 | FlyBaseID: | FBgn0037562 | Length: | 140 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001343826.1 | Gene: | si:ch211-260e23.7 / 100004554 | ZFINID: | ZDB-GENE-141216-158 | Length: | 142 | Species: | Danio rerio |
Alignment Length: | 138 | Identity: | 38/138 - (27%) |
---|---|---|---|
Similarity: | 74/138 - (53%) | Gaps: | 1/138 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDSAISEIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGLTAYGL 65
Fly 66 TEGNFKSLSEVILNDLTESQRRELEQHVIRAISEVRNVRVRDVARLILNNRHVQEVALEAVKSYI 130
Fly 131 TDRMGMTI 138 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 105 | 1.000 | Domainoid score | I6567 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 105 | 1.000 | Inparanoid score | I4918 |
OMA | 1 | 1.010 | - | - | QHG50112 | |
OrthoDB | 1 | 1.010 | - | - | D1474873at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003581 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR31493 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X2933 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
8 | 8.170 |