DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nazo and si:ch211-260e23.7

DIOPT Version :9

Sequence 1:NP_649778.1 Gene:Nazo / 40976 FlyBaseID:FBgn0037562 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_001343826.1 Gene:si:ch211-260e23.7 / 100004554 ZFINID:ZDB-GENE-141216-158 Length:142 Species:Danio rerio


Alignment Length:138 Identity:38/138 - (27%)
Similarity:74/138 - (53%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSAISEIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGLTAYGL 65
            |:..|.:::.....:::.:.|:..::.:.||||...|.|.:||||.||.|:.:|||:||...:.:
Zfish     1 MNRQIDDVMGLCCRVSESRQIKAALQNSSKGAAAAGGGAFVGGLLGGPPGIFIGGALGGAFGWWM 65

  Fly    66 TEGNFKSLSEVILNDLTESQRRELEQHVIRAISEVRNVRVRDVARLILNNRHVQEVALEAVKSYI 130
            |.|.|..|.::|: ::...|:.:|...|:..:..:..|.:..:..|::.|..:|...|..:.|:.
Zfish    66 TSGKFHPLHQIIM-EMPPQQKNKLYSEVMAVLGNLDWVDMAQLILLVMGNSSLQMRVLTTLISFA 129

  Fly   131 TDRMGMTI 138
            |..:|..|
Zfish   130 TKELGAKI 137



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6567
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4918
OMA 1 1.010 - - QHG50112
OrthoDB 1 1.010 - - D1474873at2759
OrthoFinder 1 1.000 - - FOG0003581
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31493
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.170

Return to query results.
Submit another query.