DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and HAND2

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_068808.1 Gene:HAND2 / 9464 HGNCID:4808 Length:217 Species:Homo sapiens


Alignment Length:152 Identity:48/152 - (31%)
Similarity:68/152 - (44%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDL 226
            |...|.:...|||.|..|      ..:|..|....:....:...:..|..|...::.......|.
Human    19 PFAAAAAAAAAAAASRCS------HEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDH 77

  Fly   227 A--DGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDR 289
            :  .|....|...|.|..|      ||   |||..||.:||||.|::|.||..||:.:|.:..|.
Human    78 SHYGGVPPGAGPPGLGGPR------PV---KRRGTANRKERRRTQSINSAFAELRECIPNVPADT 133

  Fly   290 QLSKHETLQMAQTYISALGDLL 311
            :|||.:||::|.:||:.|.|||
Human   134 KLSKIKTLRLATSYIAYLMDLL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/59 (49%)
HAND2NP_068808.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 18/48 (38%)
bHLH_TS_HAND2 100..161 CDD:381477 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.