DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Twist1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_445982.1 Gene:Twist1 / 85489 RGDID:621455 Length:203 Species:Rattus norvegicus


Alignment Length:209 Identity:54/209 - (25%)
Similarity:84/209 - (40%) Gaps:51/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 MEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASA--GPKPKRSYTKKNQPSTTATSTPTAA 173
            |.|.|.|:    ||:  ||.:.:.:|.....:..|||.  |.:.:||    ::.|...::.|..|
  Rat     1 MMQDVSSS----PVS--PADDSLSNSEEEPDRQQPASGKRGARKRRS----SRRSAGGSAGPGGA 55

  Fly   174 AESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGED----FDGNDGSFDLADGENQDA 234
            ....                                 ..||::    ..|..|......|.....
  Rat    56 TGGG---------------------------------IGGGDEPGSPAQGKRGKKSAGGGGGAGG 87

  Fly   235 AAGGSGKKRRGKQITPVVK-RKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQ 298
            ..||.|....|.......: :.:|:.||.|||:|.|:||:||..||:.:|.|.:|: |||.:||:
  Rat    88 GGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLK 151

  Fly   299 MAQTYISALGDLLR 312
            :|..||..|..:|:
  Rat   152 LAARYIDFLYQVLQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 26/59 (44%)
Twist1NP_445982.1 HLH 110..160 CDD:278439 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.