DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and NIG1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_199495.1 Gene:NIG1 / 834727 AraportID:AT5G46830 Length:511 Species:Arabidopsis thaliana


Alignment Length:301 Identity:63/301 - (20%)
Similarity:100/301 - (33%) Gaps:99/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AAYNPGVTHYQFNGNTLASSSNYLSANGFISFEQA------------SSDGWIS-SSPASHRSES 84
            |:|||          .|.:.|:.:..:|....:|.            |.:|.:. :|....|..|
plant   161 ASYNP----------VLVTGSDLIYGSGCDRAKQGGDVGLQTILCIPSHNGVLELASTEEIRPNS 215

  Fly    85 PEYVDLNTMYNG-----GCNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTI 144
            ..:..:..::.|     |..| :.::.:...:|.|..||....|..||..::...:.|..|..:.
plant   216 DLFNRIRFLFGGSKYFSGAPN-SNSELFPFQLESSCSSTVTGNPNPSPVYLQNRYNLNFSTSSST 279

  Fly   145 PASA--------GPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDS 201
            .|.|        |...|:|:..:|.                   |.|:::.||            
plant   280 LARAPCGDVLSFGENVKQSFENRNP-------------------NTYSDQIQN------------ 313

  Fly   202 VEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERR 266
            |.....:||                   |.:      .||||..|   |...|.:.|.....||.
plant   314 VVPHATVML-------------------EKK------KGKKRGRK---PAHGRDKPLNHVEAERM 350

  Fly   267 RMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307
            |.:.||..|..||..:|   |..::.|...|:.|..||:.|
plant   351 RREKLNHRFYALRAVVP---NVSKMDKTSLLEDAVCYINEL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 18/55 (33%)
NIG1NP_199495.1 bHLH-MYC_N 34..225 CDD:290915 13/73 (18%)
HLH 338..389 CDD:238036 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.