powered by:
Protein Alignment ato and BHLH100
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_181657.1 |
Gene: | BHLH100 / 818723 |
AraportID: | AT2G41240 |
Length: | 242 |
Species: | Arabidopsis thaliana |
Alignment Length: | 74 |
Identity: | 25/74 - (33%) |
Similarity: | 35/74 - (47%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 239 SGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTY 303
|.:..|.....|||.:| |..||.||.|.:.:|..|..||..||.....::||...|:..|..|
plant 47 SSENNRTLLDNPVVMKK--LNHNASERERRKKINTMFSSLRSCLPPTNQTKKLSVSATVSQALKY 109
Fly 304 ISALGDLLR 312
|..|.:.::
plant 110 IPELQEQVK 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.