DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and BHLH100

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_181657.1 Gene:BHLH100 / 818723 AraportID:AT2G41240 Length:242 Species:Arabidopsis thaliana


Alignment Length:74 Identity:25/74 - (33%)
Similarity:35/74 - (47%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 SGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTY 303
            |.:..|.....|||.:|  |..||.||.|.:.:|..|..||..||.....::||...|:..|..|
plant    47 SSENNRTLLDNPVVMKK--LNHNASERERRKKINTMFSSLRSCLPPTNQTKKLSVSATVSQALKY 109

  Fly   304 ISALGDLLR 312
            |..|.:.::
plant   110 IPELQEQVK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 20/58 (34%)
BHLH100NP_181657.1 bHLH_AtORG2_like 62..136 CDD:381484 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.