DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and med29

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001072872.1 Gene:med29 / 780334 XenbaseID:XB-GENE-1006668 Length:188 Species:Xenopus tropicalis


Alignment Length:171 Identity:33/171 - (19%)
Similarity:50/171 - (29%) Gaps:76/171 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 MLFSGGEDFDGNDGSFDLADGENQDAAAG-----GSGKKRRGKQ-----ITPVVKRKRRLAANAR 263
            ||.:..:...|.:|      |..|..:.|     |..:::.|.|     ..| |:|.|.|....:
 Frog     3 MLLNQSQPPQGREG------GGTQVGSLGPGIPVGQQQQQLGLQQQQQDFDP-VQRYRMLIPQLK 60

  Fly   264 E----------RRRMQNLN------------QAFDR---------------LRQYLPCLGNDRQL 291
            |          :..:||.|            |.||:               ||....||......
 Frog    61 ESLQNLMKIAAQNLVQNTNIDNGQKNADGLVQRFDKSLEEFYAICDQLELCLRLAYECLSQSYDS 125

  Fly   292 SKH----------------------ETLQMAQTYISALGDL 310
            :||                      :.|.|.::.||...|:
 Frog   126 AKHSPTLVPTATKPDAVQTESLPYTQYLSMIKSQISCAKDI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 21/117 (18%)
med29NP_001072872.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 7/29 (24%)
Med29 45..177 CDD:371607 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165165038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.