DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurod6

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001072273.1 Gene:neurod6 / 779726 XenbaseID:XB-GENE-969227 Length:337 Species:Xenopus tropicalis


Alignment Length:90 Identity:39/90 - (43%)
Similarity:58/90 - (64%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 DGENQDAAAGGSGKKR--RGKQITPV-VKR--KRRLAANARERRRMQNLNQAFDRLRQYLPCLGN 287
            |.:.::....|..::|  |.|::|.| ::|  .||:.||||||.||..||.|.|.||:.:||...
 Frog    62 DEDREEEDENGLPRRRGPRKKKMTKVRIERIKVRRVEANARERGRMHGLNDALDNLRKVVPCYSK 126

  Fly   288 DRQLSKHETLQMAQTYISALGDLLR 312
            .::|||.|||::|:.||.||.::||
 Frog   127 TQKLSKIETLRLAKNYIWALSEILR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/60 (50%)
neurod6NP_001072273.1 bHLH_TS_NeuroD4_ATOH3 74..151 CDD:381564 35/76 (46%)
Neuro_bHLH 153..272 CDD:372170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.