DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and TCF3

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_024307437.1 Gene:TCF3 / 6929 HGNCID:11633 Length:710 Species:Homo sapiens


Alignment Length:346 Identity:78/346 - (22%)
Similarity:129/346 - (37%) Gaps:95/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YKTSEDLQGFKTAAAEPYFNPMAAYNPGVTHYQFNGNTLASSSNY--LSANGFISFEQASSDG-- 71
            |........|.::.:.|..:|..               ||.:|.:  ..|.|.:|   .|.||  
Human   369 YSPDHSSNNFSSSPSTPVGSPQG---------------LAGTSQWPRAGAPGALS---PSYDGGL 415

  Fly    72 -WISSSPASHRSESPEYV---------DLNTMY-------NGGCNNMAQNQQYGMIMEQS----- 114
             .:.|....|..|:...:         |::|:.       :|....|:...::..::...     
Human   416 HGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVSAGRGWSW 480

  Fly   115 VVSTAPAIPVAS-PPAVEVMGS----------SNVGTCKTIPASAGPKPKRSYTKKNQPSTTATS 168
            .|...||.|.|. .|.::|.||          |.:.....:|:..|..|..|     :|..:.:.
Human   481 AVGGDPAPPDAPVSPRLQVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLS-----RPPDSYSG 540

  Fly   169 TPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLML----FSGGEDFDGNDGSFDLADG 229
            ...|.|.::|| .:..||.:  |.:|::..|.|.|:.::|..    .|..||.|      ||...
Human   541 LGRAGATAAAS-EIKREEKE--DEENTSAADHSEEEKKELKAPRARTSPDEDED------DLLPP 596

  Fly   230 ENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPC---LGNDRQL 291
            |.         |..|.|:        ||:|.|||||.|::::|:||..|.:.  |   |.:::..
Human   597 EQ---------KAEREKE--------RRVANNARERLRVRDINEAFKELGRM--CQLHLNSEKPQ 642

  Fly   292 SKHETLQMAQTYISALGDLLR 312
            :|...|..|.:.|..|...:|
Human   643 TKLLILHQAVSVILNLEQQVR 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 20/61 (33%)
TCF3XP_024307437.1 Paf1 <552..606 CDD:309201 18/78 (23%)
HLH 611..664 CDD:197674 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.