DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and TCF4

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001230155.2 Gene:TCF4 / 6925 HGNCID:11634 Length:773 Species:Homo sapiens


Alignment Length:494 Identity:91/494 - (18%)
Similarity:153/494 - (30%) Gaps:198/494 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEIYRY---------YYKTSEDLQGFKTAAAEPYFNPMAAYNPGVTHYQFNGNTLASSSNYLSAN 59
            |:.|:|         .:.::.::|..|.....|.. |.:.|.|..:...:|.::....|:..:.:
Human   248 SQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL-PSSVYAPSASTADYNRDSPGYPSSKPATS 311

  Fly    60 GFIS--FEQ---ASSDGWISSS------------PASHRSESPEY----------------VDLN 91
            .|.|  |.|   .|||.|.|||            .:||..:|..|                .|:|
Human   312 TFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADIN 376

  Fly    92 -------TMYNGGCNN-----------------------MAQNQQYGMIMEQSVV---------- 116
                   |.:..|.|:                       .|.:.|.|..:.:::.          
Human   377 SSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNN 441

  Fly   117 --STAPAIPVASPPAVE---VMGSSNVGTCKTIPASAGPKPKRS--------------YTKKNQP 162
              |:.|:.||.|||::.   .:.|.|.|...:.|...||.....              :..:|..
Human   442 SFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHA 506

  Fly   163 STTATSTP-----------------------------TAAAESSASVNLYTE------------- 185
            ...:|:.|                             .:|...|..|..:.|             
Human   507 VGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLP 571

  Fly   186 --------------------------------EFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFD 218
                                            :.|:....:|.:..|. |.||:|......||..
Human   572 NQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDD-EGDENLQDTKSSEDKK 635

  Fly   219 GNDGSFDL-----ADGENQDAAAGGSGKKRRGKQITPVVK----RKRRLAANARERRRMQNLNQA 274
            .:|...|:     :...|.|           .:.:||..|    ::||:|.|||||.|::::|:|
Human   636 LDDDKKDIKSITRSRSSNND-----------DEDLTPEQKAEREKERRMANNARERLRVRDINEA 689

  Fly   275 FDRLRQYLPC-LGNDRQLSKHETLQMAQTYISALGDLLR 312
            |..|.:.:.. |.:|:..:|...|..|...|.:|...:|
Human   690 FKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVR 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 21/63 (33%)
TCF4NP_001230155.2 HLH 676..729 CDD:197674 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.