DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and TAL2

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens


Alignment Length:56 Identity:26/56 - (46%)
Similarity:39/56 - (69%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            |::..|.|||.|.||:|.||.:||:.:|....|::|||:|||::|..||:.|..:|
Human     3 RKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 25/54 (46%)
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 26/56 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.