DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and tcf3b

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001166154.1 Gene:tcf3b / 664768 ZFINID:ZDB-GENE-051113-64 Length:652 Species:Danio rerio


Alignment Length:396 Identity:95/396 - (23%)
Similarity:142/396 - (35%) Gaps:146/396 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DLQGFKTAAAEPYFNPMAAYNPGVTHYQFNGNTLASSSNYLSANGFISFEQASSDG------WIS 74
            |:.||.:.:        |||:        :.:::..|.:.|::.|.:    |||.|      ..|
Zfish   256 DVNGFHSGS--------AAYS--------HTSSINGSDSILASRGTV----ASSSGDEIGKALAS 300

  Fly    75 SSPASHRSE-----------SPEYV--------------DLNTMYNGGC----NNMAQNQQYGM- 109
            ..|:.|.|.           ||:.:              .|:..|.||.    |.|....:..: 
Zfish   301 IYPSDHNSNNFSSTPSTPVGSPQGIATGATQWSRASGQAALSPNYEGGLHALQNKMEDRLEEAIH 365

  Fly   110 IMEQSVVSTAPAIPVASP------PAVEV----MGS-----SNVG--TCKTIPASAGPKPKRSYT 157
            ::....|..||.||.|..      .||..    |||     ||.|  .....||.||     |:.
Zfish   366 VLRSHAVGQAPGIPGAHADMHGLLSAVSTSSASMGSIPQAYSNAGLPLSNRHPAMAG-----SHH 425

  Fly   158 KKN---QPSTT------ATSTP------------------TAAAESSASVNLYTEEFQNFDFDNS 195
            ..:   .||:|      |:.||                  ..|..||...::..||.:  |.:||
Zfish   426 DDHACLPPSSTLLQSAHASGTPQPGGAPEAFNTSGLPGGLAHATHSSNKSDIKREEKE--DDENS 488

  Fly   196 ALFDDSVEDDED------------LMLFSG----GEDFDGNDGSFDLADGENQDAAAGGSGKKRR 244
            ::.|.|.|:.::            ..:.||    |||.:.:|...||.          ...|..|
Zfish   489 SVADKSEEEKKESKPRTRPRKEVFSQVLSGVSDQGEDLNEDDDDEDLP----------AEVKVER 543

  Fly   245 GKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPC---LGNDRQLSKHETLQMAQTYISA 306
            .|:        ||:|.|||||.|::::|:||..|.:.  |   |.||:..:|...|..|...|..
Zfish   544 EKE--------RRVANNARERLRVRDINEAFKELGRM--CQLHLSNDKPQTKLLILHQAVNVILN 598

  Fly   307 LGDLLR 312
            |...:|
Zfish   599 LEQQVR 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 22/61 (36%)
tcf3bNP_001166154.1 HLH 552..605 CDD:197674 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.