DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurog3

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_067732.1 Gene:Neurog3 / 60329 RGDID:631350 Length:214 Species:Rattus norvegicus


Alignment Length:120 Identity:46/120 - (38%)
Similarity:57/120 - (47%) Gaps:18/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 FSGGEDFD-----GNDGSFDLADGENQDAAAG---GSGKK---RRGKQITP-------VVKRKRR 257
            |.|..|.:     ....|..|...:..:|.||   |:.:|   |||.:..|       ..:|.||
  Rat    21 FPGASDHEVLSSNSTPPSPTLVPRDCSEAEAGDCRGTSRKLRARRGGRNRPKSELALSKQRRSRR 85

  Fly   258 LAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            ..||.|||.||.|||.|.|.||..||...:|.:|:|.|||:.|..||.||...||
  Rat    86 KKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/58 (52%)
Neurog3NP_067732.1 bHLH_TS_NGN3_ATOH5 77..144 CDD:381561 32/64 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.