DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Bhlhe22

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_067535.3 Gene:Bhlhe22 / 59058 MGIID:1930001 Length:355 Species:Mus musculus


Alignment Length:274 Identity:73/274 - (26%)
Similarity:102/274 - (37%) Gaps:86/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PASHRSESPEYVDLNTMYNGGCNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTC 141
            |||  |.||.          ||...|..:..|:::               ||.....|:|..|..
Mouse    54 PAS--SSSPL----------GCFEPADPEGAGLLL---------------PPPGGGGGASGGGGG 91

  Fly   142 KTIP------ASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDD 200
            .::|      |..|.:|..|            |.|..||....    |.|.........|:..:.
Mouse    92 VSVPGLLVGSAGVGGEPSLS------------SLPAGAALCLK----YGESAGRGSVAESSGGEQ 140

  Fly   201 SVEDDED----LMLFSGGED----FDGNDGSFDLADG------------------ENQDAAAGGS 239
            |.:||.|    |:|.:||.|    .....||..:|:|                  ....:..||.
Mouse   141 SPDDDSDGRCELVLRAGGPDPRASPGAGGGSAKVAEGCSNAHLHGGSGLPPGGPTSGGGSGGGGG 205

  Fly   240 GKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETLQMAQT 302
            |..::.|:     ::..||..||||||||.:||.|.|.||..:|...:.  |:|||..||.:|:.
Mouse   206 GSSKKSKE-----QKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKN 265

  Fly   303 YI----SALGDLLR 312
            ||    .||.::.|
Mouse   266 YILMQAQALEEMRR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 28/64 (44%)
Bhlhe22NP_067535.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..90 14/62 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..215 18/91 (20%)
HLH 222..276 CDD:197674 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.