powered by:
Protein Alignment ato and atoh7
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571707.1 |
Gene: | atoh7 / 58216 |
ZFINID: | ZDB-GENE-000926-1 |
Length: | 134 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 37/57 - (64%) |
Similarity: | 47/57 - (82%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 255 KRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
:||:|||||||:|||.||.||||||:.:|..|.|::|||:||||||.:||.||..:|
Zfish 28 RRRMAANARERKRMQGLNTAFDRLRKVVPQWGQDKKLSKYETLQMALSYIMALNRIL 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170578675 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4395 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19290 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2611 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.870 |
|
Return to query results.
Submit another query.