DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and atoh7

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_571707.1 Gene:atoh7 / 58216 ZFINID:ZDB-GENE-000926-1 Length:134 Species:Danio rerio


Alignment Length:57 Identity:37/57 - (64%)
Similarity:47/57 - (82%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            :||:|||||||:|||.||.||||||:.:|..|.|::|||:||||||.:||.||..:|
Zfish    28 RRRMAANARERKRMQGLNTAFDRLRKVVPQWGQDKKLSKYETLQMALSYIMALNRIL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 37/57 (65%)
atoh7NP_571707.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
HLH 29..80 CDD:278439 34/50 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578675
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.