DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and AgaP_AGAP000878

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_001688970.1 Gene:AgaP_AGAP000878 / 5666740 VectorBaseID:AGAP000878 Length:387 Species:Anopheles gambiae


Alignment Length:178 Identity:51/178 - (28%)
Similarity:69/178 - (38%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 ASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLML 210
            :|..| |||...|:||...|....|....:....:..|...            |:.:.....:..
Mosquito     2 SSLNP-PKRLKLKENQMVVTMRDLPAGPLKRKLPLGNYVSA------------DNVLPPAVTIAT 53

  Fly   211 FSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAF 275
            .:.           .|| |....|..|..|:||..:..|.|...:||   |||||.|:|.:|..|
Mosquito    54 LAK-----------QLA-GAGPPAGLGLPGRKRSSEPRTAVSAVERR---NARERNRVQQVNNGF 103

  Fly   276 DRLRQYLP------------CLGNDRQLSKHETLQMAQTYISALGDLL 311
            ..|||.:|            ..|..::|||.|||:||..||.:|..||
Mosquito   104 AALRQRIPDEIADAFEAGTTARGVHKKLSKVETLRMAVEYIKSLERLL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/71 (41%)
AgaP_AGAP000878XP_001688970.1 HLH 96..153 CDD:197674 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.