DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and myf6

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_012814547.1 Gene:myf6 / 549914 XenbaseID:XB-GENE-998203 Length:244 Species:Xenopus tropicalis


Alignment Length:147 Identity:44/147 - (29%)
Similarity:61/147 - (41%) Gaps:33/147 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 FQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITP- 250
            |...|.||.|.        :.|.:..|...:.|::|:  |:...:|..|..||........:.| 
 Frog    11 FFYLDGDNGAF--------QQLGVADGSPVYPGSEGT--LSPCRDQLPADAGSDSSEEEHVLAPP 65

  Fly   251 ----------------VVKRK-----RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKH 294
                            ..|||     ||.||..|||||::.:|:||:.|::......|.| |.|.
 Frog    66 GLQPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQR-LPKV 129

  Fly   295 ETLQMAQTYISALGDLL 311
            |.|:.|..||..|.|||
 Frog   130 EILRSAINYIERLQDLL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/64 (45%)
myf6XP_012814547.1 BASIC 2..96 CDD:128794 20/94 (21%)
bHLH_TS_MRF4_Myf6 91..154 CDD:381504 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.