powered by:
Protein Alignment ato and mespb
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016653.1 |
Gene: | mespb / 549407 |
XenbaseID: | XB-GENE-970939 |
Length: | 292 |
Species: | Xenopus tropicalis |
Alignment Length: | 67 |
Identity: | 29/67 - (43%) |
Similarity: | 44/67 - (65%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 243 RRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLP--CLGNDRQLSKHETLQMAQTYIS 305
:|||:.|..:...:|.:|:.||:.||:||::|...||:||| ....|:.|:|.||||:..:|||
Frog 84 KRGKKNTGKLPYSQRQSASEREKLRMRNLSKALQNLRRYLPPSVAPLDKTLTKIETLQLTISYIS 148
Fly 306 AL 307
.|
Frog 149 HL 150
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ato | NP_731223.1 |
HLH |
253..312 |
CDD:238036 |
25/57 (44%) |
mespb | NP_001016653.1 |
HLH |
97..150 |
CDD:278439 |
24/52 (46%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.