DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Atoh1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001102708.1 Gene:Atoh1 / 500156 RGDID:1565171 Length:351 Species:Rattus norvegicus


Alignment Length:182 Identity:62/182 - (34%)
Similarity:85/182 - (46%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PKPKRSYTKKNQP----------ST--TATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSV 202
            |:|..:...::.|          ||  .|..|||.....:|....|...........:|...|..
  Rat    33 PQPPATLQARDHPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPGDEA 97

  Fly   203 EDDEDLMLFSGGEDFDGNDGSF-------DLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAA 260
            :...:|:..||......:.|..       .|..|...|.......:....||:.. |:::|||||
  Rat    98 DGQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNG-VQKQRRLAA 161

  Fly   261 NARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            ||||||||..||.|||:||..:|...||::|||:|||||||.||:||.:||:
  Rat   162 NARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 38/58 (66%)
Atoh1NP_001102708.1 HLH 155..213 CDD:238036 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.