DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and atoh1b

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001122151.1 Gene:atoh1b / 493915 ZFINID:ZDB-GENE-041201-1 Length:206 Species:Danio rerio


Alignment Length:84 Identity:44/84 - (52%)
Similarity:60/84 - (71%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 NQDAAAGGSGKKRRGKQIT---PVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLS 292
            ::|..||  .|.|.|.:.:   |  :|.||:||||||||||..||:|||:||..:|.|.|:::||
Zfish    70 SEDHHAG--SKARPGSKASVSGP--QRHRRVAANARERRRMHGLNRAFDKLRSVIPSLENEKKLS 130

  Fly   293 KHETLQMAQTYISALGDLL 311
            |::||||||.||:.|.:||
Zfish   131 KYDTLQMAQIYITELSELL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 37/59 (63%)
atoh1bNP_001122151.1 HLH 92..150 CDD:238036 37/58 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26546
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.