DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and olig3

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001008191.1 Gene:olig3 / 493553 XenbaseID:XB-GENE-919789 Length:263 Species:Xenopus tropicalis


Alignment Length:152 Identity:47/152 - (30%)
Similarity:71/152 - (46%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 TSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGEN 231
            :|:.::.|.|....::|.......|...|     ||...::.||....|:.....||    .|| 
 Frog     5 SSSMSSRASSPDMEDMYLRSHHRPDNRMS-----SVSSTQNDMLQKMSEEMLSKHGS----RGE- 59

  Fly   232 QDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKH 294
                 |.|.|.:..||::....::.||..|.|||:||.:||.|.|.||:.:|.....  |:|||.
 Frog    60 -----GESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKI 119

  Fly   295 ETLQMAQTYI----SALGDLLR 312
            .||.:|:.||    |:|.::.|
 Frog   120 ATLLLARNYILMLTSSLEEMKR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 26/64 (41%)
olig3NP_001008191.1 bHLH_SF 64..144 CDD:381792 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.