DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ato and NEUROG1

DIOPT Version :9

Sequence 1:	NP_731223.1	Gene:	ato / 40975	FlyBaseID:	FBgn0010433	Length:	312	Species:	Drosophila melanogaster
Sequence 2:	NP_006152.2	Gene:	NEUROG1 / 4762	HGNCID:	7764	Length:	237	Species:	Homo sapiens

Alignment Length:	131	Identity:	45/131 - (34%)
Similarity:	60/131 - (45%)	Gaps:	37/131 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   219 GNDGSFDLADGEN-----QDAAAGG--------------------------SGKKRRGK------ 246
            |:|.|..|.|.|:     |.|:|.|                          ..::|||:
Human    19 GSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQERRRRRGRTRVRSE 83

  Fly   247 QITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            .:...::|.||:.||.|||.||.|||.|.|.||..||...:|.:|:|.|||:.|..||.||.:.|
Human    84 ALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETL 148

  Fly   312 R 312
            |
Human   149 R 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ato	NP_731223.1	HLH	253..312	CDD:238036	30/58 (52%)
NEUROG1	NP_006152.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	35..83		7/47 (15%)
		HLH	90..149	CDD:238036	30/58 (52%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	175..209
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165145405
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840