| Sequence 1: | NP_731223.1 | Gene: | ato / 40975 | FlyBaseID: | FBgn0010433 | Length: | 312 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006152.2 | Gene: | NEUROG1 / 4762 | HGNCID: | 7764 | Length: | 237 | Species: | Homo sapiens |
| Alignment Length: | 131 | Identity: | 45/131 - (34%) |
|---|---|---|---|
| Similarity: | 60/131 - (45%) | Gaps: | 37/131 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 219 GNDGSFDLADGEN-----QDAAAGG--------------------------SGKKRRGK------ 246
Fly 247 QITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
Fly 312 R 312 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ato | NP_731223.1 | bHLH_TS_amos_like | 250..311 | CDD:381558 | 30/60 (50%) |
| NEUROG1 | NP_006152.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 35..83 | 7/47 (15%) | |
| bHLH_TS_NGN1_NeuroD3 | 82..153 | CDD:381559 | 32/68 (47%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 175..209 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||