DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and NEUROD2

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_006151.3 Gene:NEUROD2 / 4761 HGNCID:7763 Length:382 Species:Homo sapiens


Alignment Length:196 Identity:58/196 - (29%)
Similarity:78/196 - (39%) Gaps:60/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEF 187
            |...|||               |....|.|.|:  .|..|......|....||......|..|| 
Human    37 PPPPPPA---------------PGPGAPGPARA--AKPVPLRGEEGTEATLAEVKEEGELGGEE- 83

  Fly   188 QNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVV 252
                       ::..|::|.|                |.|:||.         .|:||.:...:.
Human    84 -----------EEEEEEEEGL----------------DEAEGER---------PKKRGPKKRKMT 112

  Fly   253 KRK------RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            |.:      ||..||||||.||.:||.|.|.||:.:||....::|||.|||::|:.||.||.::|
Human   113 KARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 177

  Fly   312 R 312
            |
Human   178 R 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/64 (47%)
NEUROD2NP_006151.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 31/145 (21%)
bHLH_TS_NeuroD2 88..180 CDD:381563 42/116 (36%)
Nuclear localization signal. /evidence=ECO:0000255 107..113 0/5 (0%)
Neuro_bHLH 180..310 CDD:403655
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.