Sequence 1: | NP_731223.1 | Gene: | ato / 40975 | FlyBaseID: | FBgn0010433 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006151.3 | Gene: | NEUROD2 / 4761 | HGNCID: | 7763 | Length: | 382 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 58/196 - (29%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 60/196 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 PVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEF 187
Fly 188 QNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVV 252
Fly 253 KRK------RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
Fly 312 R 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ato | NP_731223.1 | HLH | 253..312 | CDD:238036 | 30/64 (47%) |
NEUROD2 | NP_006151.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..129 | 31/145 (21%) | |
bHLH_TS_NeuroD2 | 88..180 | CDD:381563 | 42/116 (36%) | ||
Nuclear localization signal. /evidence=ECO:0000255 | 107..113 | 0/5 (0%) | |||
Neuro_bHLH | 180..310 | CDD:403655 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165145421 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |