DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and ATOH1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens


Alignment Length:200 Identity:68/200 - (34%)
Similarity:89/200 - (44%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PVASPPAVEVMGSSNVGTCKTIPASAGP--KPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTE 185
            |...|||             |:.|...|  .|:.|......|  .|...||.....:|....|..
Human    33 PPPQPPA-------------TLQAREHPVYPPELSLLDSTDP--RAWLAPTLQGICTARAAQYLL 82

  Fly   186 EFQNFDFDNSALFDDSVEDDEDLM-LFSGGEDFDGNDGSF-------DLADGENQDAAAGGSGKK 242
            .........:|...|.|:...:|: ..|||.....:.|..       .|..|...|.......:.
Human    83 HSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRA 147

  Fly   243 RRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307
            ...||:.. |:::|||||||||||||..||.|||:||..:|...||::|||:|||||||.||:||
Human   148 PSSKQVNG-VQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINAL 211

  Fly   308 GDLLR 312
            .:||:
Human   212 SELLQ 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 38/58 (66%)
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 8/34 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 8/30 (27%)
HLH 158..216 CDD:238036 38/57 (67%)