DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and MYOD1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_002469.2 Gene:MYOD1 / 4654 HGNCID:7611 Length:320 Species:Homo sapiens


Alignment Length:154 Identity:46/154 - (29%)
Similarity:61/154 - (39%) Gaps:39/154 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 TEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGN----------------DGSFDLADGENQ 232
            |::|          :||...|..||..|   ||.|..                ..:...|.|..:
Human    26 TDDF----------YDDPCFDSPDLRFF---EDLDPRLMHVGALLKPEEHSHFPAAVHPAPGARE 77

  Fly   233 DA-AAGGSGKKRRGKQI---TPVVKRK-----RRLAANARERRRMQNLNQAFDRLRQYLPCLGND 288
            |. ....||..:.|:.:   ....|||     ||.||..|||||:..:|:||:.|::......|.
Human    78 DEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQ 142

  Fly   289 RQLSKHETLQMAQTYISALGDLLR 312
            | |.|.|.|:.|..||..|..|||
Human   143 R-LPKVEILRNAIRYIEGLQALLR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 27/63 (43%)
MYOD1NP_002469.2 BASIC 19..114 CDD:128794 22/100 (22%)
bHLH_TS_MYOD1_Myf3 105..165 CDD:381506 24/60 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..219
Myf5 191..259 CDD:403446
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.