DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and MYCN

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001280157.1 Gene:MYCN / 4613 HGNCID:7559 Length:464 Species:Homo sapiens


Alignment Length:269 Identity:51/269 - (18%)
Similarity:81/269 - (30%) Gaps:109/269 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAES 176
            |.:.|..|||...|:.||  |...:.:......|..|.|:|....|........:||     .|.
Human   201 EPAPVPAAPASAPAAGPA--VASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTS-----GED 258

  Fly   177 SASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDA------- 234
            :.|           |.|:.   ||..||:|:               ..|:...|.:.:       
Human   259 TLS-----------DSDDE---DDEEEDEEE---------------EIDVVTVEKRRSSSNTKAV 294

  Fly   235 -----------AAGGSGKKRRGKQI----------------TPVVK------------------- 253
                       ||.|.|:.:..:.|                :|.|:                   
Human   295 TTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPL 359

  Fly   254 --------------------RKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQ 298
                                .:||...|..||:|..:|..:|..||.::|.|..:.:.:|...|:
Human   360 KSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILK 424

  Fly   299 MAQTYISAL 307
            .|..|:.:|
Human   425 KATEYVHSL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 17/94 (18%)
MYCNNP_001280157.1 Myc_N 10..372 CDD:279405 34/206 (17%)
Interaction with AURKA. /evidence=ECO:0000269|PubMed:27837025 19..47
Interaction with AURKA and FBXW7. /evidence=ECO:0000269|PubMed:27837025 61..89
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..172
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..294 27/128 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..392 6/57 (11%)
HLH 379..438 CDD:238036 17/55 (31%)
Leucine-zipper 433..454 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.