Sequence 1: | NP_731223.1 | Gene: | ato / 40975 | FlyBaseID: | FBgn0010433 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001280157.1 | Gene: | MYCN / 4613 | HGNCID: | 7559 | Length: | 464 | Species: | Homo sapiens |
Alignment Length: | 269 | Identity: | 51/269 - (18%) |
---|---|---|---|
Similarity: | 81/269 - (30%) | Gaps: | 109/269 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 EQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAES 176
Fly 177 SASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDA------- 234
Fly 235 -----------AAGGSGKKRRGKQI----------------TPVVK------------------- 253
Fly 254 --------------------RKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQ 298
Fly 299 MAQTYISAL 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ato | NP_731223.1 | HLH | 253..312 | CDD:238036 | 17/94 (18%) |
MYCN | NP_001280157.1 | Myc_N | 10..372 | CDD:279405 | 34/206 (17%) |
Interaction with AURKA. /evidence=ECO:0000269|PubMed:27837025 | 19..47 | ||||
Interaction with AURKA and FBXW7. /evidence=ECO:0000269|PubMed:27837025 | 61..89 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 129..172 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 196..294 | 27/128 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 334..392 | 6/57 (11%) | |||
HLH | 379..438 | CDD:238036 | 17/55 (31%) | ||
Leucine-zipper | 433..454 | 1/1 (100%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |