DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and MYC

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_002458.2 Gene:MYC / 4609 HGNCID:7553 Length:454 Species:Homo sapiens


Alignment Length:330 Identity:64/330 - (19%)
Similarity:107/330 - (32%) Gaps:99/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSEIYRYYYKTSEDLQGFKTAAAEPYFNPMAAYNPGVTH-YQFNGNTLASSSNYLSANGFISFE 65
            |:|.:|         ||....||:|       ..:|.|.. |..|.::...|.....::.|    
Human   187 STSSLY---------LQDLSAAASE-------CIDPSVVFPYPLNDSSSPKSCASQDSSAF---- 231

  Fly    66 QASSDGWISSSPASHRSESPEYVDLNTMYNGGCNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAV 130
            ..|||..:||:.:|.:. |||.:.|:.......::.::.:|    .::..:.........:|...
Human   232 SPSSDSLLSSTESSPQG-SPEPLVLHEETPPTTSSDSEEEQ----EDEEEIDVVSVEKRQAPGKR 291

  Fly   131 EVMGSSNVGTCKTIPASAGPKP---KRSYTKKNQ-----PSTTATSTPTAAAESSASVNLYTEEF 187
            ...||.:.|.....|.|    |   ||.:...:|     |.:|....|.|......||.:..:..
Human   292 SESGSPSAGGHSKPPHS----PLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQIS 352

  Fly   188 QNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVV 252
            .|                                                   :|....:.:...
Human   353 NN---------------------------------------------------RKCTSPRSSDTE 366

  Fly   253 KRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL---------- 307
            :..:|...|..||:|...|.::|..||..:|.|.|:.:..|...|:.|..||.::          
Human   367 ENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISE 431

  Fly   308 GDLLR 312
            .||||
Human   432 EDLLR 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 19/68 (28%)
MYCNP_002458.2 Myc_N 21..360 CDD:279405 43/252 (17%)
HLH 370..426 CDD:238036 17/55 (31%)
Myc-LZ 423..453 CDD:280500 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.