DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and AgaP_AGAP005930

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_001237735.1 Gene:AgaP_AGAP005930 / 4576357 VectorBaseID:AGAP005930 Length:464 Species:Anopheles gambiae


Alignment Length:122 Identity:46/122 - (37%)
Similarity:56/122 - (45%) Gaps:36/122 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LADGENQDAAA------------------GGS--------------GKKR--RGKQITPV--VKR 254
            :|.|..||||.                  ||:              ||.|  |.:..|.|  :||
Mosquito    97 MAAGNKQDAAGSFCPSLGVQTSTPVKPAPGGAEGEMEQKPKRKYAMGKSRITRNRSPTQVMRIKR 161

  Fly   255 KRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            .|||.||.|||.||..||:|.:|||..||....|.:|:|.|||:.|..||.:|..||
Mosquito   162 VRRLKANDRERNRMHTLNEALERLRLTLPTFPEDTKLTKIETLRFAYNYIFSLVQLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 32/59 (54%)
AgaP_AGAP005930XP_001237735.1 HLH 163..214 CDD:278439 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.