DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and net

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:237 Identity:59/237 - (24%)
Similarity:90/237 - (37%) Gaps:71/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QYGMIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSY-------------- 156
            :|....:.:||.|.|||.  |||.     :|.:.:...:.....|.|...|              
  Fly   120 RYTSSADSAVVLTPPAID--SPPP-----NSCIPSTLRLQHEIMPNPAHIYVRHPGVTTLHRSLA 177

  Fly   157 ------------TKKNQ------PSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVE 203
                        |.|.|      |...|.|......:.||...|  :|....:..:|:..:.|: 
  Fly   178 AHPEQLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTL--KERTQKESTSSSFLEASL- 239

  Fly   204 DDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGS---GKKRRGKQITPVVKRKRRLAANARER 265
            .||||                      |:...|..|   ..:|..|.:|    |:||:.||||||
  Fly   240 SDEDL----------------------NKTGLAPISRPHQHQRNYKNMT----RERRIEANARER 278

  Fly   266 RRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307
            .|:..::.|::.|||.:|...:.::|||...|::|.:||..|
  Fly   279 TRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 23/55 (42%)
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.