DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and tx

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster


Alignment Length:154 Identity:47/154 - (30%)
Similarity:72/154 - (46%) Gaps:25/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 TEEFQNF-DFDNSALFDDSVEDDEDLMLFSGGEDF----------DGNDG-SFDLADGENQ-DAA 235
            |.|..|: |.::.|...||.:..:.....:.||.:          ...|| |.:|||.:.: |..
  Fly     5 TYELHNYADLNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPI 69

  Fly   236 AGGSGKKR-----RGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLP-------CLGND 288
            |..:.|.|     :.|...|.:.:.||..||||||.||:.:|.||:.||..:|       ....:
  Fly    70 AEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTN 134

  Fly   289 RQLSKHETLQMAQTYISALGDLLR 312
            .:|:|..||::|..||:.|.|.:|
  Fly   135 EKLTKITTLRLAMKYITMLTDSIR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 25/65 (38%)
txNP_001287543.1 HLH 95..154 CDD:278439 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.