DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and sage

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:255 Identity:62/255 - (24%)
Similarity:100/255 - (39%) Gaps:70/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SSPASHRSESPEYVDLNTMYNGGCNNMAQNQQYGMIME-QSVVSTAPAIPVASPPAVEVMG---- 134
            |...:..||.|..::|....:..|..::.|  |.:..: ..:::.||..|.:..|:  |||    
  Fly    36 SEGEAESSEQPVLLELGAPQSSSCPAVSLN--YTLTADGAGLLAYAPTHPHSYSPS--VMGGYEK 96

  Fly   135 -SSNVGTCKTIPA--SAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSA 196
             :.|:|   .:|.  |..|:|...:    .....||.:|.....:..|                 
  Fly    97 EAHNMG---LLPPTYSVIPQPVSMW----HAGQVATGSPVGLECNKPS----------------- 137

  Fly   197 LFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRK------ 255
                .:......|.:|||          .:|:....|.|          |:..|..:.|      
  Fly   138 ----ELVPPPMYMSYSGG----------SIANSTEVDIA----------KEHNPAWREKALQMEK 178

  Fly   256 --RRLAANARERRRMQNLNQAFDRLRQYLP-CLGNDRQLSKHETLQMAQTYISALGDLLR 312
              ||.|.: |||.||:::|:|||.||..|| ...|.::.||.|:|::|..||:.|..:||
  Fly   179 DYRRTACD-RERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 26/67 (39%)
sageNP_524287.1 HLH 181..233 CDD:278439 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.