DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and tap

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:218 Identity:58/218 - (26%)
Similarity:77/218 - (35%) Gaps:92/218 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGE---------------DFDG------- 219
            :|..|.|:...|:|:||         |||:|....||.|               ||..       
  Fly     2 AACYNAYSAGSQSFEFD---------EDDDDASFDSGYEKSFETEAQLSSRRRLDFGTPPTPAIP 57

  Fly   220 ---NDGSFD--------------LADGENQDAAAGGS---------------------------- 239
               :.|::|              |....|....:|.:                            
  Fly    58 QPYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPED 122

  Fly   240 ------------GKKR--RGKQITPVV--KRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND 288
                        ||.|  |.:..|.||  ||.||:.||.|||.||.|||.|.::||..||.|..:
  Fly   123 PNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEE 187

  Fly   289 RQLSKHETLQMAQTYISALGDLL 311
            .:|:|.|.|:.|..||.||..:|
  Fly   188 TKLTKIEILRFAHNYIFALEQVL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/59 (51%)
tapNP_524124.1 HLH 155..207 CDD:278439 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.