DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Bhlhe22

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001102410.1 Gene:Bhlhe22 / 365748 RGDID:1305451 Length:352 Species:Rattus norvegicus


Alignment Length:273 Identity:72/273 - (26%)
Similarity:101/273 - (36%) Gaps:87/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PASHRSESPEYVDLNTMYNGGCNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTC 141
            |||  |.||.          ||...|..:..|:::               ||.....|:|..|. 
  Rat    54 PAS--SSSPL----------GCFEPADPEGAGLLL---------------PPPGGGGGASGGGV- 90

  Fly   142 KTIP------ASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDD 200
             ::|      |..|.:|..|            |.|..||....    |.|.........|:..:.
  Rat    91 -SVPGLLVGSAGVGGEPSLS------------SLPAGAALCLK----YGESAGRGSVAESSGGEQ 138

  Fly   201 SVEDDED----LMLFSGGED----FDGNDGSFDLADG-----------------ENQDAAAGGSG 240
            |.:||.|    |:|.:||.|    .....|...:|:|                 .:.....||.|
  Rat   139 SPDDDSDGRCELVLRAGGPDPRASPGAGSGGAKVAEGCSNAHLHGGSGLPPGGPTSGSGGNGGGG 203

  Fly   241 KKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETLQMAQTY 303
            ..::.|:     ::..||..||||||||.:||.|.|.||..:|...:.  |:|||..||.:|:.|
  Rat   204 SSKKSKE-----QKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNY 263

  Fly   304 I----SALGDLLR 312
            |    .||.::.|
  Rat   264 ILMQAQALEEMRR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 28/64 (44%)
Bhlhe22NP_001102410.1 HLH 219..273 CDD:197674 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.