DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and dimm

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:186 Identity:52/186 - (27%)
Similarity:73/186 - (39%) Gaps:51/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 STTATSTPTAAA---ESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSF 224
            |...:|.|...|   .|..|.|.|..|..    |:|:..||:          |||.......||.
  Fly    41 SAEGSSRPVRRATRRTSQLSNNTYDLEMT----DSSSQSDDT----------SGGGGSSNGGGST 91

  Fly   225 ---------------DLADGENQDAAAG-------------------GSGKKRRGKQITPVVKRK 255
                           ....|..|.|::|                   |:..:||...:....:..
  Fly    92 TNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNM 156

  Fly   256 RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            |||.:|.|||.||.:||.||..||:.:|.:..:|:|||.|||.:|:.||..|..::
  Fly   157 RRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHII 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 27/59 (46%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.