DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and amos

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:274 Identity:82/274 - (29%)
Similarity:110/274 - (40%) Gaps:122/274 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YLSANGFISFEQ-----------ASSDGWISSSPASHRSESPEYVDLNTMYNGGCNNMAQNQQYG 108
            :||.:.|...||           :.|||..|.|...: .::|..::|..|.|      ||.||..
  Fly    23 FLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMY-YDTPSVLELEHMLN------AQEQQQH 80

  Fly   109 MIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPS------TTAT 167
            .:.             |:|     :|.:.           |..|:  |..|.|.|      :|:.
  Fly    81 HLQ-------------ANP-----LGKNQ-----------GRSPR--YWNKQQRSKPYDKLSTSM 114

  Fly   168 STPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQ 232
            |:.|::|.||:|              :||.|              |||                 
  Fly   115 SSSTSSASSSSS--------------SSAGF--------------GGE----------------- 134

  Fly   233 DAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETL 297
                               |.:||||||||||||||.:||.|||:||..:|.||:||:|||:|||
  Fly   135 -------------------VLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETL 180

  Fly   298 QMAQTYISALGDLL 311
            ||||.||   |||:
  Fly   181 QMAQAYI---GDLV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 41/59 (69%)
amosNP_477446.1 HLH 137..195 CDD:238036 41/58 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470262
Domainoid 1 1.000 68 1.000 Domainoid score I6373
eggNOG 1 0.900 - - E1_KOG4395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.