DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Oli

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:207 Identity:60/207 - (28%)
Similarity:86/207 - (41%) Gaps:62/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PAIPVASPPAV-----EVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATS---TPTAAAES 176
            || |.||||..     ..:||..:|...........:|.   |.:|:|..:|..   :|||||.:
  Fly    33 PA-PTASPPQSVPGRRTPLGSVGLGGFYAQGMGMSQQPP---TDENKPGPSAPEKPLSPTAAAIA 93

  Fly   177 SASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGK 241
            :.:::..|                     ..:.:.|||....|::               .|..|
  Fly    94 AIAISGGT---------------------TTVAVSSGGASGSGSN---------------SGKQK 122

  Fly   242 KRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETLQMAQTYI 304
            .|:||.:        ||..||||||||.:||.|.|.||..:|...:.  |:|||..||.:|:.||
  Fly   123 NRQGKTV--------RLNINARERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYI 179

  Fly   305 ----SALGDLLR 312
                :||.:|.|
  Fly   180 LMQQNALEELRR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/64 (45%)
OliNP_001188830.1 HLH 134..188 CDD:197674 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.