DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and ID1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_002156.2 Gene:ID1 / 3397 HGNCID:5360 Length:155 Species:Homo sapiens


Alignment Length:103 Identity:28/103 - (27%)
Similarity:44/103 - (42%) Gaps:21/103 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LADGENQDAAAGGSGKKRRGKQITPVVKRKR------------------RLAANARERR---RMQ 269
            :|.|....||||.|...:.||..:...:..|                  ||.|...|::   .:.
Human     3 VASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLY 67

  Fly   270 NLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307
            ::|..:.||::.:|.|..:|::||.|.||....||..|
Human    68 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 19/76 (25%)
ID1NP_002156.2 bHLH_dnHLH_ID1 62..113 CDD:381534 14/44 (32%)
Nuclear export signal. /evidence=ECO:0000250 98..111 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.