DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and AgaP_AGAP003876

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_310434.4 Gene:AgaP_AGAP003876 / 3290921 VectorBaseID:AGAP003876 Length:443 Species:Anopheles gambiae


Alignment Length:90 Identity:29/90 - (32%)
Similarity:44/90 - (48%) Gaps:20/90 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 KRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLP-----------------CLG--- 286
            |.:.|.....:.:.||..||||||.||:.:|.||:.||:.:|                 |.|   
Mosquito    94 KEKPKPKAAPLSKYRRKTANARERSRMREINSAFENLRRAVPVAVAGTSGTSSPVSSPQCSGSAA 158

  Fly   287 NDRQLSKHETLQMAQTYISALGDLL 311
            :..:|:|..||::|..||..|.|::
Mosquito   159 SSEKLTKITTLRLAMKYIRILSDMI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 27/79 (34%)
AgaP_AGAP003876XP_310434.4 HLH 108..179 CDD:278439 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.