DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Msc

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_008761698.1 Gene:Msc / 312897 RGDID:1305496 Length:220 Species:Rattus norvegicus


Alignment Length:204 Identity:64/204 - (31%)
Similarity:89/204 - (43%) Gaps:63/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VASPPAVEVMGSSNVGTCKTIPASAGP---KPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTE 185
            |:.|...|:.|...|   ...|||..|   :|:|||.   .||                      
  Rat     6 VSDPEDTEMRGLQRV---YPAPASKRPPLLRPERSYA---SPS---------------------- 42

  Fly   186 EFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADG------ENQDAAAGGSGKKRR 244
                   |||:    :.|:|.|      ||:..|..|:   |.|      ...||:..|.|....
  Rat    43 -------DNSS----AEEEDPD------GEEEPGTVGA---AGGCKRKRPRGADASGAGGGAGST 87

  Fly   245 GKQITP------VVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTY 303
            ||:..|      ..|:.:|.|||||||.||:.|::||.||:..||.:..|.:|||.:||::|.:|
  Rat    88 GKKALPPKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSY 152

  Fly   304 ISALGDLLR 312
            |:.|..||:
  Rat   153 IAHLRQLLQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/58 (50%)
MscXP_008761698.1 bHLH_TS_musculin 102..167 CDD:381546 30/60 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.