DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Olig2

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001094027.1 Gene:Olig2 / 304103 RGDID:1307098 Length:323 Species:Rattus norvegicus


Alignment Length:208 Identity:57/208 - (27%)
Similarity:85/208 - (40%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 MIMEQSVVSTAPAIPVASP---PAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTP 170
            |..:.|:||:.|:.|....   ||....|||:..|..|:.:                ||.:...|
  Rat     1 MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSS----------------STPSDCPP 49

  Fly   171 TAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAA 235
            ..::|.                 ..|:........:.|    ||..|..:..|    ...:..:|
  Rat    50 ELSSEL-----------------RGAMGTAGAHPGDKL----GGGGFKSSSSS----TSSSTSSA 89

  Fly   236 AGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETLQ 298
            |..|.||.: ||:|....::.||..|:|||:||.:||.|.|.||:.:|.....  |:|||..||.
  Rat    90 ATSSTKKDK-KQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLL 153

  Fly   299 MAQTYISALGDLL 311
            :|:.||..|.:.|
  Rat   154 LARNYILMLTNSL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 26/61 (43%)
Olig2NP_001094027.1 bHLH_TS_OLIG2 95..179 CDD:381510 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.