DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and atoh1a

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio


Alignment Length:195 Identity:67/195 - (34%)
Similarity:91/195 - (46%) Gaps:58/195 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTAT------STPTAAAE--SSASVNLY 183
            |||:.:|.||:               .|::....|..|.|.      .:|.::||  ||||    
Zfish    30 PPALALMASSD---------------PRAWLAPVQAGTCAAHAEYLLHSPGSSAEGVSSAS---- 75

  Fly   184 TEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRR-GKQ 247
                   :|..|:.....|   .:|....|                    |.....|::|. ..:
Zfish    76 -------NFRKSSKSPVKV---RELCRLKG--------------------AVGADEGRQRAPSSK 110

  Fly   248 ITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            .|.||:::||:||||||||||..||.|||.||..:|...||::|||:|||||||.||:||.|||:
Zfish   111 STNVVQKQRRMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALSDLLQ 175

  Fly   313  312
            Zfish   176  175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 38/58 (66%)
atoh1aNP_571166.2 HLH 117..175 CDD:238036 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578689
Domainoid 1 1.000 76 1.000 Domainoid score I8909
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26546
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.