DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurog1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_571116.1 Gene:neurog1 / 30239 ZFINID:ZDB-GENE-990415-174 Length:208 Species:Danio rerio


Alignment Length:114 Identity:45/114 - (39%)
Similarity:56/114 - (49%) Gaps:22/114 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 DGSFDLADGENQDAA-----------------AGGSGKKR-----RGKQITPVVKRKRRLAANAR 263
            |.||...|.|:..::                 ||...|||     |.:....|||:.|||.||.|
Zfish    14 DYSFSHTDDEDSRSSLHPASPASSCGKPPASPAGLQQKKRRRGRARNETTVHVVKKNRRLKANDR 78

  Fly   264 ERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            ||.||.|||.|.|.||..||...:|.:|:|.|||:.|..||.||.:.:|
Zfish    79 ERNRMHNLNDALDALRSVLPAFPDDTKLTKIETLRFAHNYIWALSETIR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 31/58 (53%)
neurog1NP_571116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 11/47 (23%)
CCDC106 <20..>102 CDD:292422 30/81 (37%)
HLH 68..127 CDD:238036 31/58 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.