DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurog2

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_008759703.1 Gene:Neurog2 / 295475 RGDID:1309061 Length:263 Species:Rattus norvegicus


Alignment Length:141 Identity:48/141 - (34%)
Similarity:61/141 - (43%) Gaps:42/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EDDEDLML------FSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPV---------- 251
            |:||:|..      ..|.|...|..||           :|.|:|..|.|:.:..|          
  Rat    40 EEDEELRRPGAARGQRGAEAGQGVQGS-----------SASGAGGCRPGRLLGLVHECKRRPSRA 93

  Fly   252 ---------------VKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQ 301
                           :|:.|||.||.|||.||.|||.|.|.||:.||....|.:|:|.|||:.|.
  Rat    94 RAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAH 158

  Fly   302 TYISALGDLLR 312
            .||.||.:.||
  Rat   159 NYIWALTETLR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 31/58 (53%)
Neurog2XP_008759703.1 HLH 110..169 CDD:238036 31/58 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.