DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurog1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_062080.1 Gene:Neurog1 / 29410 RGDID:3167 Length:244 Species:Rattus norvegicus


Alignment Length:97 Identity:37/97 - (38%)
Similarity:56/97 - (57%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 GSFDLADGENQDAAAGGSGKKRRGK------QITPVVKRKRRLAANARERRRMQNLNQAFDRLRQ 280
            |:.::..|::::.    ..::|||:      .:...::|.||:.||.|||.||.|||.|.|.||.
  Rat    58 GASNVPGGQDEEQ----ERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRS 118

  Fly   281 YLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            .||...:|.:|:|.|||:.|..||.||.:.||
  Rat   119 VLPSFPDDTKLTKIETLRFAYNYIWALAETLR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/58 (52%)
Neurog1NP_062080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..84 5/29 (17%)
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559 32/68 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.