DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurod4

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_739568.2 Gene:neurod4 / 266958 ZFINID:ZDB-GENE-030730-1 Length:348 Species:Danio rerio


Alignment Length:108 Identity:44/108 - (40%)
Similarity:59/108 - (54%) Gaps:16/108 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GGEDFDGNDGSFDLADGENQDAAAGGSGK---KRRGKQITPVVK------RKRRLAANARERRRM 268
            |.||.|..       :.|.:|...|..|:   ||||.:...:.|      |.||:.||||||.||
Zfish    53 GSEDMDEE-------EEEEEDEEMGLDGEKAPKRRGPKKKKMTKARQERFRARRIKANARERSRM 110

  Fly   269 QNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            ..||.|.|.||:.:||....::|||.|||::|:.||.||.::|
Zfish   111 HGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 32/65 (49%)
neurod4NP_739568.2 HLH 98..154 CDD:238036 30/56 (54%)
Neuro_bHLH 156..272 CDD:289310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.