Sequence 1: | NP_731223.1 | Gene: | ato / 40975 | FlyBaseID: | FBgn0010433 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037281.3 | Gene: | Ahr / 25690 | RGDID: | 2074 | Length: | 853 | Species: | Rattus norvegicus |
Alignment Length: | 198 | Identity: | 39/198 - (19%) |
---|---|---|---|
Similarity: | 68/198 - (34%) | Gaps: | 56/198 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 RYYYKTSEDLQGFKTAAAEPYFNPMAAYNPGVTHYQFNGNTLASSSNYLSANGFISFEQASSDGW 72
Fly 73 ISSSPAS--HRSESPEYVDLNTMYNGGCNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAVEVMGS 135
Fly 136 SNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASV---NLYTEEFQNFDFDNSAL 197
Fly 198 FDD 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ato | NP_731223.1 | HLH | 253..312 | CDD:238036 | |
Ahr | NP_037281.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | ||
HLH | 36..77 | CDD:238036 | |||
DNA-binding. /evidence=ECO:0000250|UniProtKB:P35869 | 37..65 | ||||
PAS | 111..>181 | CDD:279347 | |||
PAS | 111..177 | CDD:214512 | |||
Required for maintaining the overall integrity of the AHR:ARNT heterodimer and its transcriptional activity. /evidence=ECO:0000250|UniProtKB:P30561 | 116..124 | ||||
Required for maintaining the overall integrity of the AHR:ARNT heterodimer and its transcriptional activity. /evidence=ECO:0000250|UniProtKB:P30561 | 264..266 | ||||
PAS | 280..384 | CDD:238075 | |||
PAS_3 | 295..380 | CDD:285623 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 429..451 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |