DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Ahr

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_037281.3 Gene:Ahr / 25690 RGDID:2074 Length:853 Species:Rattus norvegicus


Alignment Length:198 Identity:39/198 - (19%)
Similarity:68/198 - (34%) Gaps:56/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RYYYKTSEDLQGFKTAAAEPYFNPMAAYNPGVTHYQFNGNTLASSSNYLSANGFISFEQASSDGW 72
            |.:|.....|||  ||...||.:.:              :::..:.|:...|..:..|.  |.|.
  Rat   676 RKHYSLFSGLQG--TAQEFPYKSEV--------------DSMPYTQNFAPCNQSLLPEH--SKGT 722

  Fly    73 ISSSPAS--HRSESPEYVDLNTMYNGGCNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAVEVMGS 135
            ....|..  .||..|...:|....:  |..:.:||::|:..:.::||          |.....|:
  Rat   723 QLDFPGRDFERSLHPNASNLEDFVS--CLQVPENQRHGINSQSAMVS----------PQAYYAGA 775

  Fly   136 SNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASV---NLYTEEFQNFDFDNSAL 197
            .::..|:     |||:                .||....:.|..:   ..:..:||:....|.|.
  Rat   776 MSMYQCQ-----AGPQ----------------HTPVDQMQYSPEIPGSQAFLSKFQSPSILNEAY 819

  Fly   198 FDD 200
            ..|
  Rat   820 SAD 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036
AhrNP_037281.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
HLH 36..77 CDD:238036
DNA-binding. /evidence=ECO:0000250|UniProtKB:P35869 37..65
PAS 111..>181 CDD:279347
PAS 111..177 CDD:214512
Required for maintaining the overall integrity of the AHR:ARNT heterodimer and its transcriptional activity. /evidence=ECO:0000250|UniProtKB:P30561 116..124
Required for maintaining the overall integrity of the AHR:ARNT heterodimer and its transcriptional activity. /evidence=ECO:0000250|UniProtKB:P30561 264..266
PAS 280..384 CDD:238075
PAS_3 295..380 CDD:285623
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.