DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Scx

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006520723.1 Gene:Scx / 20289 MGIID:102934 Length:232 Species:Mus musculus


Alignment Length:119 Identity:45/119 - (37%)
Similarity:61/119 - (51%) Gaps:16/119 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 VEDDEDLMLFSGGEDFD---------GNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRR 257
            :.:|||....|.|.|..         |..|:...|.|..    |.|||....|:   |..:.::|
Mouse    23 LSEDEDRGSESSGSDEKPCRVHAARCGLQGARRRAGGRR----AAGSGPGPGGR---PGREPRQR 80

  Fly   258 LAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            ..||||||.|..::|.||..||..:|....||:|||.|||::|.:|||.||::|
Mouse    81 HTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/59 (49%)
ScxXP_006520723.1 bHLH_TS_scleraxis 76..143 CDD:381521 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.