DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Ptf1a

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus


Alignment Length:284 Identity:73/284 - (25%)
Similarity:110/284 - (38%) Gaps:90/284 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FNGNTLASSSNYLSANGFISFEQAS------SDGWISSSPA-----SHRSESPEYVDLNTMYNGG 97
            |.|......|.|.....|.: :|:|      ||..:....|     ||:.....|.|      |.
Mouse     9 FPGGLDTFPSPYFDEEDFFT-DQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRD------GA 66

  Fly    98 CNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAVEVMG--SSNVGTC--KTIPASAGPKPKRSYTK 158
            |           ::.|...|.||  ...:||.:...|  ..||..|  ...|.:|.|     |:.
Mouse    67 C-----------LLLQPAPSAAP--HALAPPPLGDPGEPEDNVSYCCDAGAPLAAFP-----YSP 113

  Fly   159 KNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGS 223
            .:.||..|  .|.||                                    :.|.|....|.:|:
Mouse   114 GSPPSCLA--YPCAA------------------------------------VLSPGARLGGLNGA 140

  Fly   224 FDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND 288
                      |||..:.::||.:....:  ::.|.|||.|||||||::|.||:.||.::|.|..:
Mouse   141 ----------AAAAAARRRRRVRSEAEL--QQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE 193

  Fly   289 RQLSKHETLQMAQTYISALGDLLR 312
            ::|||.:||::|..||:.|.:|::
Mouse   194 KRLSKVDTLRLAIGYINFLSELVQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 28/58 (48%)
Ptf1aNP_061279.2 HLH 162..217 CDD:238036 28/54 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.